PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa01g022550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-PHD
Protein Properties Length: 734aa    MW: 81303.6 Da    PI: 4.4916
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa01g022550.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.12.6e-12623668853
                     -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     t+  +++L   F++n+yp+++++e LAk+l++t  qV++WF+ rR+
  Csa01g022550.1 623 TDPKTQRLYISFQENQYPDKATKESLAKELQMTIMQVSNWFKHRRY 668
                     5667899999***********************************7 PP

2PHD38.82.1e-13269324151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C +     +++++lCdg C++ fH++Cl+++l+++++p +  +wlC+ C++k
  Csa01g022550.1 269 FCAKCASkdLSVDNDIILCDGfCDRGFHQYCLEPPLRKDDIPPDdeSWLCPGCDCK 324
                     699999955455********88*******************99999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579034.65E-13260324IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.1E-12266323IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.11267324IPR019787Zinc finger, PHD-finger
SMARTSM002497.9E-9269322IPR001965Zinc finger, PHD-type
CDDcd155047.89E-27269321No hitNo description
PfamPF006287.6E-11269324IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590270321IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.609.6E-13605667IPR009057Homeodomain-like
PROSITE profilePS5007112.082613673IPR001356Homeobox domain
SMARTSM003898.5E-10615677IPR001356Homeobox domain
SuperFamilySSF466891.11E-11620668IPR009057Homeodomain-like
CDDcd000861.92E-11623668No hitNo description
PfamPF000469.6E-10623668IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 734 aa     Download sequence    Send to blast
MNGAAAFKRV TRSSTSGLKQ INVDSGDEVN NPTVDNVSEQ GNASVPLKPS EAGSQMPNDA  60
NGTIRGNGKG KEVQTPTPQT GKKRSTTKTK FSGSYRELVI GLPCRGQFEI QRSRSSKSSK  120
RLGGGGERNV VFSSHKSAQR SKDAAGSSSV AANNTPVGRR PRKRNKTMKK GEVREDDEYT  180
RNKKKLRYLL KRINYEQNLI DAYSLEGWRG SSLEKLRPEK ELERATKEIL RCKVKIRDLF  240
QHLDTLCAEG SLPVSLFDSD GAISSDDIFC AKCASKDLSV DNDIILCDGF CDRGFHQYCL  300
EPPLRKDDIP PDDESWLCPG CDCKDDSLDL LNDSLGTKLS VSDSWEKIFP EAAAALAGGD  360
QNLNCDLPSD DSDDEEYDPD GLNDNENDED NSDDSDESEN KDGSSDESDF TSASDEMIES  420
FKEGKDIMAD IMALPSDDSE DDDYDPEAPT RDEDEIQESS NSDCTSDSED IETSFKGNES  480
NQEDEATPLE YPGRKKSQLP YDAISESDAV LDDGLAGVPR RRNVERLDYK KLYDEEYENV  540
PSSSSDDDDY KTTIMGKEDS ESEDEGDTVP LKQSSNAEDH TSKKPRRKSK RADKKDTLEV  600
PQQGPGENGC SGEKSSSTAY KQTDPKTQRL YISFQENQYP DKATKESLAK ELQMTIMQVS  660
NWFKHRRYVK SKPVVSEEAV EKSKTGKEGE CGRSVAGSSK QTTMETESAS ESNNPGSRKR  720
RREFLDSIKT VYI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180186RNKKKLR
2582590KKPRRKSKR
3717721RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1171050.0AK117105.1 Arabidopsis thaliana At3g19510 mRNA for putative homeobox protein HAT3.1, complete cds, clone: RAFL16-64-G01.
GenBankBT0059650.0BT005965.1 Arabidopsis thaliana At3g19510 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010507796.10.0PREDICTED: homeobox protein HAT3.1-like
SwissprotQ049960.0HAT31_ARATH; Homeobox protein HAT3.1
TrEMBLR0G2870.0R0G287_9BRAS; Uncharacterized protein
STRINGAT3G19510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72702543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.10.0Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain